Recombinant Proteins
- (2)
- (970)
- (1)
- (23,543)
- (5)
- (1)
- (1)
- (67)
- (219)
- (4,425)
- (23)
- (1)
- (4)
- (2)
- (13)
- (21,461)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (71)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (254)
- (22,606)
- (1)
- (1)
- (2)
- (1)
- (13)
- (26,166)
- (266)
- (32)
- (3)
- (708)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (108)
- (1)
- (3,782)
- (1,408)
- (3)
- (4)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (14)
- (138)
- (48)
- (6)
- (17)
- (2)
- (1)
- (4)
- (81)
- (12)
- (2)
- (3)
- (80)
- (4)
- (113)
- (96)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,525)
- (2)
- (1)
- (3)
- (18)
- (48)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (201)
- (1)
- (4)
- (1)
- (2)
- (114)
- (44)
- (2)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (23,710)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (1)
- (1)
- (6,728)
- (6)
- (4)
- (1)
- (3)
- (1)
- (3)
- (2)
- (13)
- (17)
- (1)
- (3)
- (3)
- (4)
- (25,926)
- (240)
- (1)
- (3)
- (286)
- (2)
- (61,756)
- (1)
- (15)
- (1)
- (2)
- (45,218)
- (5,703)
- (245)
- (168)
- (56)
- (3,364)
- (2)
- (1)
- (2)
- (1)
- (21)
- (559)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (1)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,050)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (26,022)
- (5)
- (1)
- (4)
- (582)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (120)
- (9)
- (2)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,574)
- (1)
- (48)
- (7)
- (1)
- (3)
- (18)
- (2)
- (62)
- (1)
- (4)
- (2)
- (9)
- (59)
- (1)
- (2)
- (3)
- (1)
- (391)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (6)
- (19)
- (7)
- (2)
- (2)
- (3)
- (45)
- (1)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (2)
- (8)
- (2)
- (3)
- (38,959)
- (1)
- (11)
Filtered Search Results
R&D Systems™ Recombinant Human ULBP-1 Fc Chimera Protein
Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Binding Activity
R&D Systems™ Recombinant Human SMOC-1 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity
R&D Systems™ Recombinant Human Serpin C1/Antithrombin-III Protein
Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Inhibition Activity
Novus Biologicals™ Recombinant Plant Arachis hypogaea 1.0101 Strep (N-Term) Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein
Novus Biologicals™ Recombinant Plant Betula verrucosa 6.0102 Strep (N-Term) Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein
R&D Systems™ Recombinant Human ALCAM Fc Chimera (HEK293-expressed)
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
| Accession Number | P01566.1 |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie™ Blue Staining. |
| Conjugate | Unconjugated |
| Gene Alias | IFNA10, IFNalpha C, IFN-alpha C, IFN-alpha-10, IFN-alphaC, interferon alpha-10, Interferon alpha-6 L, Interferon alpha-C, interferon, alpha 10, LeIF C, MGC119878, MGC119879 |
| Molecular Weight (g/mol) | MolecularWeight-observed: 18-22 kDa, under reducing conditions., MolecularWeight-theroretical: 19 kDa |
| Gene ID (Entrez) | 3446 |
| Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. |
| Reconstitution | Reconstitute at 100 μg/mL in PBS. |
| Endotoxin Concentration | <0.10 EU / 1 μg of the protein by the LAL method. |
| Storage Requirements | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20°C to -70°C as supplied. 1 month, 2°C to 8°C under sterile conditions after reconstitution. 3 months, -20°C to -70°C under sterile conditions after reconstitution. |
| For Use With (Application) | Bioactivity |
| Protein | IFN-alpha C/IFN-alpha 10 |
| Source | Human embryonic kidney cell, HEK293-derived human IFN-alpha 10/IFNA10 protein Cys24-Asp189 |
Novus Biologicals™ LYPLA1 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >90% |
| Conjugate | Unconjugated |
| Common Name | LYPLA1 |
| Molecular Weight (g/mol) | 26.8kDa |
| Gene ID (Entrez) | 10434 |
| Formulation | Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol 0.1M NaCl, 1mM DTT |
| Immunogen | LYPLA1, 1-230 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLLPPID |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 0.5mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |
R&D Systems™ Recombinant Mouse TWEAK/TNFSF12 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity
| Purity or Quality Grade | 90%, by SDS-PAGE under reducing conditions and visualized by silver stain. |
|---|---|
| Conjugate | Unconjugated |
| Molecular Weight (g/mol) | 17 kDa |
| Gene ID (Entrez) | 21944 |
| Quantity | 25 μg |
| Storage Requirements | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution. |
| Source | E. coli-derived mouse TWEAK/TNFSF12 protein Arg105-His249,with an N-terminal Met and a 6-His tag |
| Recombinant | Recombinant |
| Name | TWEAK/TNFSF12 |
R&D Systems™ Recombinant Human IL-35 Fc Chimera Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
R&D Systems™ Recombinant Rat OX40 Ligand/TNFSF4 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
R&D Systems™ Recombinant Mouse Mimecan Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity
R&D Systems™ Recombinant Human Serpin E2/PN1 Protein
Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Inhibition Activity